HPA023361

TSTA3 antibody from Sigma-Aldrich
FX, P35B, SDR4E1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023361
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023361, RRID:AB_1858420
Product name
Anti-TSTA3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023361
Antibody type
Polyclonal
Antigen
GDP-L-fucose synthetase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSS
KDADLTDTAQTRALFEKVQPTHVIHLAAMVG
Storage
-20C
Provider Type Product Number
- No reagents -