HPA017199

C9orf91 antibody from Sigma-Aldrich
DKFZp547P234, FLJ38045
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017199
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017199, RRID:AB_1845845
Product name
Anti-C9orf91 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017199
Antibody type
Polyclonal
Antigen
Transmembrane protein C9orf91 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SVIQLWFVYFDLENCVQFLSDHVQEMKTSQESLLR
SRLSQLCVVMETGVSPATAEGPENLEDAPLLPGNS
CPNERPLMQTELHQLVPEAEPEEMARQLLAVFGGY
YIRLLVTSQ
Storage
-20C
Provider Type Product Number
- No reagents -