Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405908 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Transmembrane Protein 57 (TMEM57) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TMEM57 antibody: synthetic peptide directed towards the N terminal of human TMEM57
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
VVWALVLLADFVLEFRFEYLWPFWLFIRSVYDSFR
YQGLA FSVFFVCVAF- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification of a novel brain-specific and Reelin-regulated gene that encodes a protein colocalized with synapsin.
Kuvbachieva A, Bestel AM, Tissir F, Maloum I, Guimiot F, Ramoz N, Bourgeois F, Moalic JM, Goffinet AM, Simonneau M
The European journal of neuroscience 2004 Aug;20(3):603-10
The European journal of neuroscience 2004 Aug;20(3):603-10
No comments: Submit comment
No validations: Submit validation data