HPA019359

C7orf43 antibody from Sigma-Aldrich
FLJ10925
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019359
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019359, RRID:AB_1848677
Product name
Anti-C7orf43 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019359
Antibody type
Polyclonal
Antigen
Uncharacterized protein C7orf43 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LRTGLFELSQHMKLKLQFTASVSHPPPEARPLSRK
SSPSSPAVRDLVERHQASLGRSQSFSHQQPSRSHL
MRSGSVMERRAITPPVASPVGRPLYLPPDKAVLSL
DKIAKRECKVLVVE
Storage
-20C
Provider Type Product Number
- No reagents -