HPA017936

YARS antibody from Sigma-Aldrich
tyrRS, YRS, YTS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017936
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017936, RRID:AB_1858916
Product name
Anti-YARS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017936
Antibody type
Polyclonal
Antigen
Tyrosyl-tRNA synthetase, cytoplasmic recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPL
LSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFA
EKYLPALGYSKRVHLMNPMVPGLTGSKMSSSEEES
KIDLLDRKEDVKK
Storage
-20C
Provider Type Product Number
- No reagents -