HPA017936

antibody from Atlas Antibodies

Targeting: YARS1 tyrRS, YARS, YRS, YTS

Antibody data

Submit

Validation data

Product number: HPA017936 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA017936, RRID:AB_1858916
Product name: Anti-YARS
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPL LSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFA EKYLPALGYSKRVHLMNPMVPGLTGSKMSSSEEES KIDLLDRKEDVKK
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

YARS1 protein structure - HPA017936 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, liver and pancreas using Anti-YARS antibody HPA017936 (A) shows similar protein distribution across tissues to independent antibody HPA018950 (B).
Antibody #2 product nr: HPA018950, HPA018954
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows distinct cytoplasmic and membranous positivity in tubular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-YARS antibody HPA017936.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas using Anti-YARS antibody HPA017936.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-YARS antibody HPA017936.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-YARS antibody HPA017936.
Sample type: HUMAN