HPA021284

FAM129B antibody from Sigma-Aldrich
bA356B19.6, C9orf88, DKFZP434H0820, FLJ13518, FLJ22151, FLJ22298, MINERVA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021284
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021284, RRID:AB_1848373
Product name
Anti-FAM129B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021284
Antibody type
Polyclonal
Antigen
Niban-like protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EVTDMNLNVINEGGIDKLGEYMEKLSRLAYHPLKM
QSCYEKMESLRLDGLQQRFDVSSTSVFKQRAQIHM
REQMDNAVYTFETLLHQELGKGPTKEELCKSIQRV
Storage
-20C
Provider Type Product Number
- No reagents -