HPA024430

C17orf53 antibody from Sigma-Aldrich
MGC3130
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024430
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024430, RRID:AB_1853879
Product name
Anti-C17orf53 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024430
Antibody type
Polyclonal
Antigen
Uncharacterized protein C17orf53 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTRSTMDASVVFKDPTGEMQGTVHRLLLETCQNEL
KPGSVLLLKQIGVFSPSLRNHYLNVTPNNLVHIYS
PDSGDGSFLKPSQPFPKDSGSFQHDVAAKPEEGFR
TAQNLEAEASPEEELPEADDLDGLLSELPEDFFCG
TS
Storage
-20C
Provider Type Product Number
- No reagents -