HPA027141

ADPRHL2 antibody from Atlas Antibodies
ARH3, FLJ20446
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027141
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027141, RRID:AB_1844619
Product name
Anti-ADPRHL2
Provider product page
Atlas Antibodies - HPA027141
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VGSFYEAHDTVDLTSVLRHVQSLEPDPGTPGSERT
EALYYTDDTAMARALVQSLLAKEAFDEVDMAHRFA
QEYKKDPDRGYGAGVV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -