HPA022990

C9orf114 antibody from Sigma-Aldrich
CENP-32, HSPC109
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022990
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022990, RRID:AB_1845797
Product name
Anti-C9orf114 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022990
Antibody type
Polyclonal
Antigen
Uncharacterized protein C9orf114 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QYLRKAFFPKHQDLQFAGLLNPLDSPHHMRQDEES
EFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLE
PGLRVTVRLNQQQHPDCKTYHGKVVSSQDPRTKAG
LYWGYTVRLASC
Storage
-20C
Provider Type Product Number
- No reagents -