Explore
Validate
LearnH00010849-M05
antibody from Abnova Corporation
Targeting: POLR1G
A34.5, ASE-1, CAST, CD3EAP, PAF49, RPA34
ELISAAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010849-M05 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010849-M05, RRID:AB_1672314
- Product name
- CD3EAP monoclonal antibody (M05), clone 6A6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CD3EAP.
- Antigen sequence
EEPQAGDAARFSCPPNFTAKPPASESPRFSLEALT
GPDTELWLIQAPADFAPECFNGRHVPLSGSQIVKG
KLAGKRHRYRVLSSCPQAGEATLLAPSTEAGGGLT
CASA- Isotype
- IgG
- Antibody clone number
- 6A6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CD3EAP is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to CD3EAP on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to CD3EAP on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
