HPA022243

C9orf9 antibody from Sigma-Aldrich
Mast
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022243
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022243, RRID:AB_1845844
Product name
Anti-C9orf9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022243
Antibody type
Polyclonal
Antigen
Uncharacterized protein C9orf9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MNEVKESLRSIEQKYKLFQQQQLTFTAALEHCREN
AHDKIRPISSIGQVQSYMEHYCNSSTDRRVLLMFL
DICSELNKLCQHFE
Storage
-20C
Provider Type Product Number
- No reagents -