HPA011286

MKL2 antibody from Sigma-Aldrich
FLJ31823, MRTF-B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011286
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011286, RRID:AB_1853973
Product name
Anti-MKL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011286
Antibody type
Polyclonal
Antigen
MKL/myocardin-like protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QRPGPMELVEKNILPVDSSVKEAIIGVGKEDYPHT
QGDFSFDEDSSDALSPDQPASQESQGSAASPSEPK
VSESPSPVTTNTPAQFASVSPTVPEFLKTPPTADQ
PPPRPAAPVLPTNTVSSAKPGPALVKQSHPKNP
Storage
-20C
Provider Type Product Number
- No reagents -