HPA024079

DARS antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024079
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024079, RRID:AB_1847480
Product name
Anti-DARS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024079
Antibody type
Polyclonal
Antigen
Aspartyl-tRNA synthetase, cytoplasmic recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DKYPLAVRPFYTMPDPRNPKQSNSYDMFMRGEEIL
SGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRF
GAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPRD
Storage
-20C
Provider Type Product Number
- No reagents -