HPA007925

YWHAQ antibody from Sigma-Aldrich
14-3-3, HS1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007925
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007925, RRID:AB_1844340
Product name
Anti-YWHAQ antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007925
Antibody type
Polyclonal
Antigen
14-3-3 protein theta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKT
DTSDKKLQLIKDYREKVESELRSICTTVLELLDKY
LIANATNPESKVFYLKMKGDYFRY
Storage
-20C
Provider Type Product Number
- No reagents -