HPA017948

FAM26F antibody from Sigma-Aldrich
C6orf187, dJ93H18.5, OTTHUMP00000017061, OTTHUMP00000017062, RP1-93H18.5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017948
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017948, RRID:AB_1844401
Product name
Anti-FAM26F antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017948
Antibody type
Polyclonal
Antigen
Protein FAM26F recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RCLSPVSFLQLKFWKIYLEQEQQILKSKATEHATE
LAKENIKCFFEGSHPKEYNTPSMKEWQQISSLYTF
NPKGQYYSMLHKYVNRKEKTHSIRSTEGDTVIPVL
GFVDSSGINSTPE
Storage
-20C
Provider Type Product Number
- No reagents -