HPA014524

FAM26D antibody from Sigma-Aldrich
C6orf78, FLJ32239
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014524
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014524, RRID:AB_1845745
Product name
Anti-FAM26D antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014524
Antibody type
Polyclonal
Antigen
Protein FAM26D recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTSLQHCYWTSHLQNERELFEQAAEQHSRLLMMHR
IKKLFGFIPGSEDVKHIRIPSCQDWKDISVPTLLC
MGDDLQGHYSFLGNRVDEDNEEDRSRGIEL
Storage
-20C
Provider Type Product Number
- No reagents -