HPA026070

PEG3 antibody from Sigma-Aldrich
KIAA0287, ZKSCAN22, ZNF904, ZSCAN24
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026070
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026070, RRID:AB_10603328
Product name
Anti-ZIM2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026070
Antibody type
Polyclonal
Antigen
PEG3 antisense RNA (non-protein coding) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSNVREYQKARAKKKYIEHRSNETSVIHSLPFGEQ
TFRPRGMLYECQECGECFAHSSDLTEHQKIHDREK
PSGSRNYEWSVIRSLAPTDPQTSYAQEQYAKEQAR
NKCKDFRQFFATSEDLNTNQKIYDQ
Storage
-20C
Provider Type Product Number
- No reagents -