HPA007603

MINA antibody from Sigma-Aldrich
FLJ14393, mdig, MINA53
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007603
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007603, RRID:AB_1853957
Product name
Anti-MINA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007603
Antibody type
Polyclonal
Antigen
MYC-induced nuclear antigen recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNF
DSPSSLFESLISPIKTETFFKEFWEQKPLLIQRDD
PALATYYGSLFKLTDLKSLCSRGMYYGRDVNVCRC
VNGKKKVLNKDGKAHFLQLRKDFDQKRATIQFHQP
QRFKDELW
Storage
-20C
Provider Type Product Number
- No reagents -