HPA012956

PNMAL1 antibody from Sigma-Aldrich
FLJ10781, KIAA1183L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012956
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012956, RRID:AB_1844328
Product name
Anti-PNMAL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012956
Antibody type
Polyclonal
Antigen
PNMA-like protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KPKGINSNSTANLEDPEVGDAESMAISEPIKGSRK
PCVNKEELALKKPMAKCAWKGPREPPQDARAEAES
PGGASESDQDGGHESPPKKKAVAWVSAKNPAPMRK
KKKVSLGPVSYVLVDSEDGRKKPVMP
Storage
-20C
Provider Type Product Number
- No reagents -