HPA009150

NPHP3 antibody from Sigma-Aldrich
CFAP31, FLJ30691, FLJ36696, KIAA2000, MKS7, NPH3, SLSN3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009150
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009150, RRID:AB_1078086
Product name
Anti-ACAD11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009150
Antibody type
Polyclonal
Antigen
Nephrocystin-3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PEFAHSSIDVEGPFANVNRDDWDIAVASLLQVTPL
FSHSLWSNTVRCYLIYTDETQPEMDLFLKDYSPKL
KRMCETMGYFFHAVYFPIDVENQYLTVRKWEIEKS
Storage
-20C
Provider Type Product Number
- No reagents -