HPA018217

ADCK3 antibody from Sigma-Aldrich
CABC1, COQ8, SCAR9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018217
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018217, RRID:AB_1845856
Product name
Anti-CABC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018217
Antibody type
Polyclonal
Antigen
Chaperone activity of bc1 complex-like, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FFHQDQSPVGGLTAEDIEKARQAKARPENKQHKQT
LSEHARERKVPVTRIGRLANFGGLAVGLGFGALAE
VAKKSLRSEDPSGKK
Storage
-20C
Provider Type Product Number
- No reagents -