HPA000843

H1F0 antibody from Sigma-Aldrich
H10, H1FV
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000843
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000843, RRID:AB_1079062
Product name
Anti-H1F0 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000843
Antibody type
Polyclonal
Antigen
Histone H1.0 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MTENSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQK
YIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGV
GASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKK
ASK
Storage
-20C
Provider Type Product Number
- No reagents -