HPA041589

antibody from Atlas Antibodies

Targeting: SQOR CGI-44, SQR, SQRDL

Antibody data

Submit

Validation data

Product number: HPA041589 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA041589, RRID:AB_2677565
Product name: Anti-SQRDL
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTV EKTWKALQDFKEGNAIFTFPNTPVKCAGAPQKIMY LSEAYFRKTGKRSKANIIFNTSLGAIFGVKKYADA LQEIIQERNLTVNYKKNLIEVRADKQEAVFENLD
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SQOR protein structure - HPA041589 shown in red.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum shows strong positivity with a granular pattern in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human stomach shows strong positivity in a subset of glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows moderate positivity in cytoplasm granular in hepatocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum shows moderate granular cytoplasmic positivity in glandular cells.
Sample type: HUMAN