HPA017079

SQRDL antibody from Sigma-Aldrich
CGI-44
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017079
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017079, RRID:AB_1857467
Product name
Anti-SQRDL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017079
Antibody type
Polyclonal
Antigen
Sulfide:quinone oxidoreductase, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNL
PTSKTAAAVAAQSGILDRTISVIMKNQTPTKKYDG
YTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKE
RLSMYLMKADLMPFLYWNMMLRGYWG
Storage
-20C
Provider Type Product Number
- No reagents -