HPA010551

CARKD antibody from Sigma-Aldrich
FLJ10769, LP3298
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010551
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010551, RRID:AB_1848669
Product name
Anti-CARKD antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010551
Antibody type
Polyclonal
Antigen
Carbohydrate kinase domain containing
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PNAVHEVEKWLPRLHALVVGPGLGRDDALLRNVQG
ILEVSKARDIPVVIDADGLWLVAQQPALIHGYRKA
VLTPNHVEFSRLYDAVLRGPMDSDDSHGSVLRLSQ
ALGNVTVVQ
Storage
-20C
Provider Type Product Number
- No reagents -