HPA009678

GRAMD3 antibody from Sigma-Aldrich
FLJ21313, NS3TP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009678
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009678, RRID:AB_2112580
Product name
Anti-GRAMD3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009678
Antibody type
Polyclonal
Antigen
GRAM domain-containing protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GKRESKLGSAHSEAENGVEEKKKACRSPTAQSPTP
SVEADSPDQKKIISLWSKSSFDGASLASDKNDCKT
ESKNDPKTERKKSSSSSQYKANMHFHKLFLSVPTE
EPLKQSFTCALQKEILYQGKLFVSENWI
Storage
-20C
Provider Type Product Number
- No reagents -