HPA008758

PRKRIR antibody from Sigma-Aldrich
DAP4, P52rIPK, THAP12
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008758
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008758, RRID:AB_1855714
Product name
Anti-PRKRIR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008758
Antibody type
Polyclonal
Antigen
52 kDa repressor of the inhibitor of the protein kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NPHSRHRKRIKELSEDEIRTLKQKKIDETSEQEQK
HKETNNSNAQNPSEEEGEGQDEDILPLTLEEKENK
EYLKSLFEILILMGKQNIPLDGHEADEIPEGLFTP
DNFQALLECRINSGEEVLRKRFE
Storage
-20C
Provider Type Product Number
- No reagents -