HPA002561

EIF1AY antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002561
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002561, RRID:AB_1078724
Product name
Anti-EIF1AY antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002561
Antibody type
Polyclonal
Antigen
Eukaryotic translation initiation factor 1A, Y-chromosomal recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKR
LCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVI
LKYNADEARSLKAYGELPEHAKINETDTFGPGDDD
EIQ
Storage
-20C
Provider Type Product Number
- No reagents -