HPA009076

FAM49B antibody from Sigma-Aldrich
BM-009
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009076
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009076, RRID:AB_1848402
Product name
Anti-FAM49B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009076
Antibody type
Polyclonal
Antigen
Protein FAM49B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GNLLKVLTCTDLEQGPNFFLDFENAQPTESEKEIY
NQVNVVLKDAEGILEDLQSYRGAGHEIREAIQHPA
DEKLQEKAWGAVVPLVGKLKKFYEFSQRLEAALRG
LLGALTSTPYSPTQHLEREQALAKQFAE
Storage
-20C
Provider Type Product Number
- No reagents -