ABIN502829

IMPAD1 antibody from antibodies-online
FLJ20421, gPAPP, IMPA3

Antibody data

Product number
ABIN502829
Provider
antibodies-online
Product name
anti-Inositol Monophosphatase Domain Containing 1 (IMPAD1) antibody
Provider product page
antibodies-online - ABIN502829
Antibody type
Polyclonal
Antigen
The immunogen for anti-IMPAD1 antibody: synthetic peptide directed towards the middle region of human IMPAD1
Reactivity
Human
Host
Rabbit
Antigen sequence
TAWAMVDGGSNVKARSSYNEKTPRIVVSRSHSGMV
KQVAL QTFGNQTTII
Vial size
50 µg
Provider Type Product Number
- No reagents -