HPA009411

IMPAD1 antibody from Sigma-Aldrich
FLJ20421, gPAPP, IMPA3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009411
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009411, RRID:AB_1079138
Product name
Anti-IMPAD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009411
Antibody type
Polyclonal
Antigen
myo-inositol monophosphatase A3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYLLK
TAFPSVQINTEEHVDAADQEVILWDHKIPEDILKE
VTTPKEVPAESVTVWIDPLDATQEYTEDLRKYVTT
MVCVAVNGK
Storage
-20C
Provider Type Product Number
- No reagents -