HPA000804

ADRBK2 antibody from Sigma-Aldrich
BARK2, GRK3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000804
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000804, RRID:AB_1078281
Product name
Anti-ADRBK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000804
Antibody type
Polyclonal
Antigen
beta-Adrenergic receptor kinase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YEAVNADTDKIEARKRAKNKQLGHEEDYALGKDCI
MHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGE
SRQNLLTMEQILSVEETQIKDKKCILFRIKGGKQF
VLQCESDPEFVQWKKELNETFKEAQRLLRRAPKFL
NKPRS
Storage
-20C
Provider Type Product Number
- No reagents -