Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1449829 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Arylsulfatase E (ARSE) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide directed towards the middle region of human ARSE
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
KVVHHDPPLLFDLSRDPSETHILTPASEPVFYQVM
ERVQQAVWEHQRTLS- Epitope
- Middle Region
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C for one month or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Clinical and molecular analysis of arylsulfatase E in patients with brachytelephalangic chondrodysplasia punctata.
Nino M, Matos-Miranda C, Maeda M, Chen L, Allanson J, Armour C, Greene C, Kamaluddeen M, Rita D, Medne L, Zackai E, Mansour S, Superti-Furga A, Lewanda A, Bober M, Rosenbaum K, Braverman N
American journal of medical genetics. Part A 2008 Apr 15;146A(8):997-1008
American journal of medical genetics. Part A 2008 Apr 15;146A(8):997-1008
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Placenta; WB Suggested Anti-ARSE Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human Placenta; ARSE antibody - middle region (AP43220PU-N) in Human Placenta cells using Western Blot