HPA008546

C2orf40 antibody from Sigma-Aldrich
augurin, ECRG4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008546
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008546, RRID:AB_2066524
Product name
Anti-C2orf40 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008546
Antibody type
Polyclonal
Antigen
Augurin Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KREAPVPTKTKVAVDENKAKEFLGSLKRQKRQLWD
RTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDR
NGHEYYGDYYQRHYDEDSAIGPRSPYGFRHGASVN
YD
Storage
-20C
Provider Type Product Number
- No reagents -