HPA012759

PVRL2 antibody from Sigma-Aldrich
CD112, HVEB, PRR2, PVRR2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012759
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012759, RRID:AB_1846227
Product name
Anti-PVRL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012759
Antibody type
Polyclonal
Antigen
Poliovirus receptor-related protein 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLV
TWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERL
SFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNY
TCEFATFPKGSVRGMTWLR
Storage
-20C
Provider Type Product Number
- No reagents -