Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310822 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Retinoic Acid Receptor Responder (Tazarotene Induced) 3 (RARRES3) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RARRES3 antibody: synthetic peptide directed towards the middle region of human RARRES3
- Description
- Protein A purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
FSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQ
PRPVE VIISSAKEMV- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Suppression of the TIG3 tumor suppressor gene in human ovarian carcinomas is mediated via mitogen-activated kinase-dependent and -independent mechanisms.
Lotz K, Kellner T, Heitmann M, Nazarenko I, Noske A, Malek A, Gontarewicz A, Schäfer R, Sers C
International journal of cancer. Journal international du cancer 2005 Oct 10;116(6):894-902
International journal of cancer. Journal international du cancer 2005 Oct 10;116(6):894-902
No comments: Submit comment
No validations: Submit validation data