HPA001221

DGCR14 antibody from Sigma-Aldrich
DGCR13, DGS-H, DGSI, ES2, Es2el
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001221
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001221, RRID:AB_1078645
Product name
Anti-DGCR14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001221
Antibody type
Polyclonal
Antigen
Protein DGCR14 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASASSLLLPAASRPPRKREAGEAGAATSKQRVLDE
EEYIEGLQTVIQRDFFPDVEKLQAQKEYLEAEENG
DLERMRQIAIKFGSALGKMSREPPPPYVTPATFET
PEVHAGTGVVGNKPRPRGRGLEDGEAGEEEEKEPL
PSLDV
Storage
-20C
Provider Type Product Number
- No reagents -