HPA010775

PVRL4 antibody from Sigma-Aldrich
LNIR, nectin-4, PRR4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010775
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010775, RRID:AB_1079720
Product name
Anti-PVRL4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010775
Antibody type
Polyclonal
Antigen
poliovirus receptor-related 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLH
SKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAV
QADEGEYECRVSTFPAGSFQARLRLRVLVPPLPSL
NPGPAL
Storage
-20C
Provider Type Product Number
- No reagents -