HPA011956

HKDC1 antibody from Sigma-Aldrich
FLJ22761, FLJ37767
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011956
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011956, RRID:AB_1850758
Product name
Anti-HKDC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011956
Antibody type
Polyclonal
Antigen
Putative hexokinase HKDC1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QGTGEELFDHIVQCIADFLDYMGLKGASLPLGFTF
SFPCRQMSIDKGTLIGWTKGFKATDCEGEDVVDML
REAIKRRNEFDLDIVAVVNDTVGT
Storage
-20C
Provider Type Product Number
- No reagents -