HPA005548

CECR5 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005548
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005548, RRID:AB_1078497
Product name
Anti-CECR5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005548
Antibody type
Polyclonal
Antigen
Cat eye syndrome critical region protein 5 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GTFLLCLETIYQKVTGKELRYEGLMGKPSILTYQY
AEDLIRRQAERRGWAAPIRKLYAVGDNPMSDVYGA
NLFHQYLQKATHDGAPELGAGGTRQQQPSASQSCI
SILVCTGVYNPRNPQSTEPVLGGGEPPFHGHRDLC
FSPGLMEASHVVNDVNEAVQLVFRKEG
Storage
-20C
Provider Type Product Number
- No reagents -