HPA010986

CCDC67 antibody from Sigma-Aldrich
FLJ25393
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010986
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010986, RRID:AB_1078422
Product name
Anti-CCDC67 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010986
Antibody type
Polyclonal
Antigen
coiled-coil domain containing 67 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MKQNKVPRKELPHLKEEIPFELSNLNQKLEEFRAK
SREWDKQEILYQTHLISLDAQQKLLSEKCNQFQKQ
AQSYQTQLNGKKQCLEDSSSEIPRLICDPDPNCEI
NERDEFIIEKLKSAVNEIALSRNKLQD
Storage
-20C
Provider Type Product Number
- No reagents -