HPA014036

DPCR1 antibody from Sigma-Aldrich
bCX105N19.6, PBLT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014036
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014036, RRID:AB_1847841
Product name
Anti-DPCR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014036
Antibody type
Polyclonal
Antigen
diffuse panbronchiolitis critical region 1 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KTTSTTEKTTRTPEKPTLYSEKTICTKGKNTPVPE
KPTENLGNTTLTTETIKAPVKSTENPEKTAAVTKT
IKPSVKVTGDKSLTTTSSHLNKTEVTHQVPTGSFT
LITSRTKLSSITSEATGNESHPYLNKDGSQK
Storage
-20C
Provider Type Product Number
- No reagents -