HPA003547

RP1-37E16.12 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003547
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003547, RRID:AB_10602012
Product name
Anti-NOL12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003547
Antibody type
Polyclonal
Antigen
nucleolar protein 12 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HQEYLKMLAEREEALEEADELDRLVTAKTESVQYD
HPNHTVTVTTISDLDLSGARLLGLTPPEGGAGDRS
EEEASSTEKPTKALPRKSRDPLLSQRISSLTASLH
AHSRKKVKRKHPRRAQDSKKPPRAPRTSKAQRRRL
TGKAR
Storage
-20C
Provider Type Product Number
- No reagents -