H00148738-A01
antibody from Abnova Corporation
Targeting: HJV
haemojuvelin, hemojuvelin, HFE2, HFE2A, JH, RGMC
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00148738-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00148738-A01, RRID:AB_529821
- Product name
- HFE2 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant HFE2.
- Antigen sequence
GGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPV
EDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFL
PDLEKLHLFPS- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Regulation of type II transmembrane serine proteinase TMPRSS6 by hypoxia-inducible factors: new link between hypoxia signaling and iron homeostasis.
Lakhal S, Schödel J, Townsend AR, Pugh CW, Ratcliffe PJ, Mole DR
The Journal of biological chemistry 2011 Feb 11;286(6):4090-7
The Journal of biological chemistry 2011 Feb 11;286(6):4090-7
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HFE2 polyclonal antibody (A01), Lot # 060519JCS1 Western Blot analysis of HFE2 expression in U-2 OS ( Cat # L022V1 ).