HPA014472

HFE2 antibody from Sigma-Aldrich
haemojuvelin, hemojuvelin, HFE2A, HJV, JH, RGMC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014472
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014472, RRID:AB_1850679
Product name
Anti-HFE2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014472
Antibody type
Polyclonal
Antigen
Hemojuvelin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DLAFHSAVHGIEDLMIQHNCSRQGPTAPPPPRGPA
LPGAGSGLPAPDPCDYEGRFSRLHGRPPGFLHCAS
FGDPHVRSFHHHFHTCRVQGAWPLLDNDFLFVQAT
SSPMALGANATATRKLTII
Storage
-20C
Provider Type Product Number
- No reagents -