SAB2101251

KIAA1024 antibody from Sigma-Aldrich
No application information provided.

Antibody data

Product number
SAB2101251
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2101251, RRID:AB_10605839
Product name
Anti-KIAA1024 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2101251
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_056021.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DNKDWHRKSKEADRQYDIPPQHRLPKQPKDGFLVE
QVFSPHPYPASLKAH
Storage
-20C
Provider Type Product Number
- No reagents -