HPA023309

SEPT7 antibody from Sigma-Aldrich
CDC10, CDC3, SEPT7A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023309
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023309, RRID:AB_10600093
Product name
Anti-SEPT7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023309
Antibody type
Polyclonal
Antigen
septin 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSVSARSAAAEERSVNSSTMVAQQKNLEGYVGFAN
LPNQVYRKSVKRGFEFTLMVVGESG
Storage
-20C
Provider Type Product Number
- No reagents -