HPA013407

FAM19A1 antibody from Sigma-Aldrich
TAFA-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013407
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013407, RRID:AB_1848386
Product name
Anti-FAM19A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013407
Antibody type
Polyclonal
Antigen
Protein FAM19A1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VKCSCLPGKVAGTTRNRPSCVDASIVIGKWWCEME
PCLEGEECKTLPDNSGWMCATGNKIKTTR
Storage
-20C
Provider Type Product Number
- No reagents -