HPA013816

KIAA1551 antibody from Sigma-Aldrich
C12orf35, FLJ10652, FLJ20696, UTA2-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013816
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013816, RRID:AB_1848661
Product name
Anti-C12orf35 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013816
Antibody type
Polyclonal
Antigen
Uncharacterized protein C12orf35 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTKLESSPRKLHKDKRQENKHKTFLPVKGNTEKSN
MLEFKLCPDILLKNTNSVEERKDVKPHPRKEQAPL
QVSGIKSTKEDWLKFVATKKRTQKDSQERDNVNSR
LSKRSFSADGFEMLQNPVKDSKEMFQTY
Storage
-20C
Provider Type Product Number
- No reagents -